If you have been reading about Beta-NMN and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-02-27. Where a claim depends on a specific study, the study is described rather than over-claimed.
Two enzymatic steps define the canonical route from nicotinamide to NAD+. Nicotinamide phosphoribosyltransferase, known as NAMPT, produces NMN from nicotinamide and phosphoribosyl pyrophosphate. NMN adenylyltransferases, or NMNAT enzymes, then couple NMN with ATP to form NAD+. Whether intact NMN crosses cell membranes efficiently remains an active area of investigation; some studies propose direct transport, while others emphasize extracellular dephosphorylation to nicotinamide riboside followed by uptake. The relative contribution of each route likely depends on cell type, tissue, and experimental conditions.
Trace amounts of NMN have been reported in certain plant foods, including edamame, avocado, broccoli, cucumber, and cabbage. Reported concentrations vary widely because analytical methods differ and food matrices complicate extraction. Endogenous production in cells is generally considered more quantitatively important than dietary intake, though precise human turnover rates are difficult to establish. Commercial NMN for research or consumer products is commonly made through enzymatic synthesis or chemical phosphorylation routes. Regulatory classification differs by country; in some jurisdictions NMN is sold as a supplement, while in others it is treated as a novel food ingredient or restricted substance.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide found in cells. Its structure combines a nicotinamide ring, a ribose sugar, and a phosphate group. As an intermediate in the NAD+ salvage pathway, NMN is converted to nicotinamide adenine dinucleotide, a coenzyme central to cellular redox reactions. NAD+ also serves as a substrate for enzymes involved in DNA repair, stress responses, and metabolic regulation. The compound is therefore part of normal cellular biochemistry rather than an exclusively synthetic molecule.
Terminology around NMN can be confusing because several related compounds share the vitamin B3 family. Nicotinamide riboside is a nucleoside, whereas NMN is a nucleotide with a phosphate group, and NAD+ is a dinucleotide coenzyme rather than a simple precursor. Niacin and nicotinamide are also NAD+ precursors but follow different metabolic entry points. In commercial and scientific writing, NMN usually refers to beta-nicotinamide mononucleotide unless another form is specified. Consistent nomenclature helps distinguish chemical identity from proposed biological effects.
Nicotinamide mononucleotide, commonly abbreviated NMN, is a pyridine nucleotide that consists of a nicotinamide ring, a ribose sugar, and a phosphate group. It is an intermediate in the salvage pathway for nicotinamide adenine dinucleotide, or NAD+, synthesis. In mammalian cells, the enzyme nicotinamide phosphoribosyltransferase produces NMN from nicotinamide and phosphoribosyl pyrophosphate. Nicotinamide mononucleotide adenylyltransferases then convert NMN into NAD+. The core structure and enzymatic route are well established in biochemical literature.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C11H15N2O8P | Canonical beta anomer; charge state depends on pH. |
| Molar mass | 334.22 g/mol | Calculated for the neutral formula. |
| CAS Registry Number | 1094-61-7 | Common identifier for beta-nicotinamide mononucleotide. |
| Appearance | White to off-white powder or crystals | Varies with purity, hydration, and polymorphism. |
| Solubility | Freely soluble in water; low solubility in nonpolar solvents | Reported values depend on salt form and temperature. |
In the canonical salvage pathway, nicotinamide phosphoribosyltransferase, known as NAMPT, transfers a phosphoribosyl group to nicotinamide and releases NMN. A second enzyme, NMN adenylyltransferase, then attaches an adenylyl group to NMN to form NAD+. Alternative routes exist, including a pathway that uses nicotinamide riboside and its phosphorylated forms. The relative contribution of extracellular NMN to intracellular NAD+ pools remains an area of active investigation, and the roles of specific transporters and enzymes are not completely defined.
NMN is present in small amounts in various foods, including certain vegetables, fruits, and milk, though dietary quantities are generally low. Laboratory research often uses synthetic or enzymatically produced NMN. The compound has drawn interest because NAD+ levels decline with age in some tissues and because restoring NAD+ may affect metabolism in animal models. Whether oral NMN produces meaningful NAD+ increases in humans and whether such changes translate into health benefits are not fully established.
NMN is present in small amounts in some foods, including certain vegetables, fruits, and animal products, but food content varies widely and is not well standardized. In laboratory research, NMN is used as a tool compound to study NAD+ metabolism, mitochondrial function, and cellular stress responses. Animal studies have reported changes in NAD+ levels and various physiological measures after NMN administration, but species differences and study designs limit direct extrapolation to humans. Human trials have largely focused on safety, tolerability, and pharmacokinetics, with fewer studies examining clinical endpoints.
Nicotinamide mononucleotide, commonly abbreviated NMN, is a naturally occurring nucleotide. Its structure consists of a nicotinamide ring attached to a ribose sugar that carries a phosphate group. The molecular formula is C11H15N2O8P, and the molar mass is about 334.22 grams per mole. In cells, NMN is an intermediate in the salvage pathway that recycles nicotinamide to maintain NAD+ levels. It is not the same compound as NAD+, although it is a direct precursor in one enzymatic step.
Research on NMN includes cell studies, animal experiments, and a growing number of human trials. Many early findings come from mice, where changes in NAD+ levels and metabolic markers have been reported. Human data are more limited, and questions remain about effective routes of administration, tissue distribution, and long-term effects. Some trials measure NAD+ in blood or tissue, while others assess physical function or metabolic outcomes. Regulatory status differs between countries, and NMN is not universally approved as a dietary supplement or therapeutic agent.
Nicotinamide mononucleotide, commonly abbreviated NMN, is a naturally occurring nucleotide. Its structure combines a nicotinamide ring with a ribose sugar and a phosphate group. The compound appears in cells across many organisms as an intermediate in the production of nicotinamide adenine dinucleotide, or NAD+. Because NMN sits close to NAD+ in metabolism, it has drawn interest in biochemistry and aging research. The molecule is not a dietary essential nutrient in the classical sense, and its presence in food is generally low and variable.
Research interest in NMN increased after animal studies reported that oral or injected NMN can raise NAD+ levels in some tissues. How NMN is absorbed and distributed in humans is not fully established. Some evidence suggests extracellular NMN may be dephosphorylated to nicotinamide riboside before cellular uptake, while other studies propose specific transport routes. Direct human data on these mechanisms remain limited. Regulatory status also varies: in some countries NMN is treated as a dietary supplement, while elsewhere it is restricted or requires approval, and these differences affect labeling, sale, and research.
Nicotinamide mononucleotide, commonly abbreviated NMN, is a naturally occurring nucleotide found in the cells of many organisms. Its structure consists of a nicotinamide group linked to a ribose sugar that carries a phosphate group. NMN is an intermediate in the biosynthesis of nicotinamide adenine dinucleotide, or NAD+, a coenzyme involved in many metabolic reactions. The abbreviation usually refers to the beta anomer, though related forms can exist. In scientific literature, NMN is distinct from nicotinamide riboside, another NAD+ precursor.
In the NAD+ salvage pathway, the enzyme NAMPT converts nicotinamide and a phosphate-donor molecule into NMN. A second enzyme, NMNAT, then converts NMN into NAD+. Nicotinamide riboside can also enter this route after being converted to NMN by nicotinamide riboside kinases. Because NMN sits at a junction between precursor uptake and NAD+ formation, its cellular concentration is tightly linked to enzyme activity and tissue type. NAD+ participates in redox reactions, signaling, and DNA repair, and its levels decline with age in some animal models, though human evidence remains more limited and context-dependent.
Indium is a shiny silvery-white, highly ductile post-transition metal with a bright luster. It is so soft (Mohs hardness 1.2) that it can be cut with a knife or be bitten into by human teeth. Indium also leaves a visible line like a pencil when rubbed on paper. It is a member of group 13 on the periodic table and its properties are mostly intermediate between its vertical neighbors gallium and thallium. As with tin, a high-pitched cry is heard when indium is bent – a crackling sound due to crystal twinning. Like gallium, indium is able to wet glass and has a low melting point, 156.60 °C (313.88 °F); higher than its lighter homologue, gallium, but lower than its heavier homologue, thallium, and lower than tin.< The boiling point is 2072 °C (3762 °F), higher than that of thallium, but lower than gallium, conversely to the general trend of melting points, but similarly to the trends down the other post-transition metal groups because of the weakness of the metallic bonding with few electrons delocalized. The density of indium, 7.31 g/cm3, is also greater than gallium, but lower than thallium. Below the critical temperature, 3.41 K, indium becomes a superconductor. Indium crystallizes in the body-centered tetragonal crystal system in the space group I4/mmm (lattice parameters: a = 325 pm, c = 495 pm): this is a slightly distorted face-centered cubic structure, where each indium atom has four neighbours at 324 pm distance and eight neighbours slightly further (336 pm).
Websites dedicated to erotic or pornographic AI-generated content primarily cater to an audience seeking personalized material. These platforms allow generating explicit content using various AI models or viewing content created by others. Tags are frequently used to refine search results, allowing users to find highly specific content by selecting attributes such as body type, facial features, sexual fetishes, general art styles, ranging from anime to realism, as well as art styles of specific artists. Many AI porn sites feature extensive image libraries and continuous feeds of user-generated content, with the ability to modify already generated images. Generative AI pornography has also been reported to reproduce stereotypes and unrealistic depictions of LGBTQ people. There are concerns that using existing pornography as training data may reinforce harmful stereotypes and fetishization.
=== Beginnings === As of 1969, the Escadrille Nationale Tchadienne was equipped with five Douglas C-47 cargo aircraft and three Max Holste MH.1521 Broussard liaison aircraft. Most of them were operated by French crews, because there were very few native pilots. In the mid-1970s, it was reinforced by six AD-4N Skyraiders, as well as some additional C-47 and Douglas C-54 transports, the total number of which reached 13 by that time. All of these were donated by France, and most were still crewed by the French. Three Reims-Cessna FTB337s were also delivered in 1977.
They have an acceptable ambient temperature range of 13–28 °C (55–82 °F), with their optimum for maximum metabolic efficiency being about 20 °C (68 °F). As ectothermal animals, common octopuses are highly influenced by changes in temperature. All species have a thermal preference where they can function at their basal metabolic rate. The low metabolic rate allows for rapid growth, thus these cephalopods mate as the water becomes closest to the preferential zone. Increasing temperatures cause an increase in oxygen consumption by O. vulgaris. Increased oxygen consumption can be directly related to the metabolic rate, because the breakdown of molecules such as glucose requires an input of oxygen, as explained by the Krebs cycle. The amount of ammonia excreted conversely decreases with increasing temperature. The decrease in ammonia being excreted is also related to the metabolism of the octopus due to its need to spend more energy as the temperature increases. Octopus vulgaris will reduce the amount of ammonia excreted in order to use the excess solutes that it would have otherwise excreted due to the increased metabolic rate. Octopuses do not regulate their internal temperatures until it reaches a threshold where they must begin to regulate to prevent death. The increase in metabolic rate shown with increasing temperatures is likely due to the octopus swimming to shallower or deeper depths to stay within its preferential temperature zone.
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
Sources: en.wikipedia.org
Eicosanoids include prostaglandins that produce fever and the dilation of blood vessels associated with inflammation and leukotrienes that attract certain white blood cells (leukocytes). Common cytokines include interleukins that are responsible for communication between white blood cells; chemokines that promote chemotaxis; and interferons that have antiviral effects, such as shutting down protein synthesis in the host cell. Growth factors and cytotoxic factors may also be released. These chemicals recruit immune cells to the site of infection and promote the healing of any damaged tissue following the removal of pathogens.
=== Ancient === Perceptions of penis size are culture-specific. Some prehistoric sculptures and petroglyphs depict male figures with exaggerated erect penises. Ancient Egyptian cultural and artistic conventions generally prohibited large penises from being shown in art, as they were considered obscene, but the scruffy, balding male figures in the Turin Erotic Papyrus are shown with exaggerated, large genitals. The Egyptian god Geb is sometimes shown with a massive erect penis and the god Min is almost always shown erect.
The New South Wales Corps, later known as the 102d Regiment of Foot, and lastly as the 100th Regiment of Foot, was a formation of the British Army organised in 1789 in England to relieve the New South Wales Marine Corps, which had accompanied the First Fleet to New South Wales. In Australia, the New South Wales Corps gained notoriety for its trade in rum and mutinous behaviour. Reconstituted as the 102d Regiment of Foot, it was transferred to Bermuda and Nova Scotia, before taking part in the Chesapeake campaign of the War of 1812. Reconstituted for the second time after the war as the 100th Regiment of Foot, it was disbanded in 1818.
=== Disease entities === In TCM, a disease has two aspects: "bìng" and "zhèng". The former is often translated as "disease entity", "disease category", "illness", or simply "diagnosis". The latter, and more important one, is usually translated as "pattern" (or sometimes also as "syndrome"). For example, the disease entity of a common cold might present with a pattern of wind-cold in one person, and with the pattern of wind-heat in another. From a scientific point of view, most of the disease entities (病; bìng) listed by TCM constitute symptoms. Examples include headache, cough, abdominal pain, constipation etc. Since therapy will not be chosen according to the disease entity but according to the pattern, two people with the same disease entity but different patterns will receive different therapy. Vice versa, people with similar patterns might receive similar therapy even if their disease entities are different. This is called yì bìng tóng zhì, tóng bìng yì zhì (异病同治，同病异治; 'different diseases same treatment', 'same disease different treatments').
Sources: en.wikipedia.org
Epithelium Photomicrographs Histology at KUMC epithel-epith02 Simple squamous epithelium of the glomerulus (kidney) Diagrams of simple squamous epithelium Histology at KUMC epithel-epith12 Stratified squamous epithelium of the vagina Histology at KUMC epithel-epith14 Stratified squamous epithelium of the skin (thin skin) Histology at KUMC epithel-epith15 Stratified squamous epithelium of the skin (thick skin) Stratified squamous epithelium of the esophagus Microanatomy Web Atlas
Einsteinium at The Periodic Table of Videos (University of Nottingham) Age-related factors in radionuclide metabolism and dosimetry: Proceedings – contains several health related studies of einsteinium
This aspect of the book has become known to a wider public through Kermani's repeated tributes to Father Paolo and his order, for example in Kermani's highly acclaimed German Publishers Association Peace Prize speech.
=== 1996–2000 === On December 31, 1996, Quest Diagnostics became an independent company as a spin-off from Corning. Kenneth W. Freeman was appointed as CEO during this transition. Over the next year, Quest acquired a clinical laboratory division of Branford, Connecticut–based Diagnostic Medical Laboratory, Inc. (DML). Two years later in 1999, Quest added SmithKline Beecham Clinical Laboratories to their subsidiaries; which includes a joint venture ownership with CompuNet Clinical Laboratory. The purchase of SmithKline Beecham also included the lab's medical sample transport airline (ICAO: LBQ, call sign: LABQUEST) originally founded in 1988. In 1997, Quest and Banner Health formed a joint venture creating the Arizona based Sonora Quest laboratory, a business unit of Laboratory Sciences of Arizona. This entity represents the operations of Quest Diagnostics in the Arizona regional market.
It is highly efficient. As the figure demonstrates, the number of peptides formed in the synthetic process (3, 9, 27, 81) increases exponentially with the number of executed cycles. Using 20 amino acids in each synthetic cycle, the number of formed peptides are 400, 8,000, 160,000 and 3,200,000, respectively. This means that the number of peptides increases exponentially with the number of the executed cycles. All peptide sequences that are formed in the process can be deduced by a combination of the amino acids used in the cycles. Portioning of the support into equal samples assures formation of the components of the library in nearly equal molar quantities. Only a single peptide forms on each bead of the support. This is the consequence of using only one amino acid in the coupling steps. It is completely unknown, however, which is the peptide that occupies a selected bead. The split-mix method can be used for the synthesis of organic or any other kind of library that can be prepared from its building blocks in a stepwise process. In 1990, three groups described methods for preparing peptide libraries by biological methods and one year later Fodor et al. published a remarkable method for synthesis of peptide arrays on small glass slides. A "parallel synthesis" method was developed by Mario Geysen and his colleagues for preparation of peptide arrays. They synthesized 96 peptides on plastic rods (pins) coated at their ends with the solid support. The pins were immersed into the solution of reagents placed in the wells of a microtiter plate.
Sources: en.wikipedia.org
NMN is nicotinamide mononucleotide, a nucleotide intermediate in NAD+ metabolism. It occurs naturally in cells and can also be produced synthetically for research or commercial use. Its name reflects its composition: nicotinamide, ribose, and a phosphate group.
NMN is a direct precursor in the NAD+ salvage pathway. NMNAT enzymes convert NMN and ATP into NAD+, a coenzyme used in many cellular reactions. This relationship makes NMN a focus of studies on NAD+ metabolism.
Small amounts of NMN have been reported in some plant foods, but measured levels vary and are not consistently quantified. Dietary contribution is generally considered minor compared with endogenous production. Food-matrix effects make accurate analysis difficult.
NMN stands for nicotinamide mononucleotide. It is a naturally occurring nucleotide intermediate in NAD+ biosynthesis.